SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_726192.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_726192.1.81976
Domain Number 1 Region: 456-730
Classification Level Classification E-value
Superfamily L domain-like 1.25e-40
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 290-545
Classification Level Classification E-value
Superfamily RNI-like 1.73e-35
Family Cyclin A/CDK2-associated p19, Skp2 0.03
Further Details:      
 
Weak hits

Sequence:  NP_726192.1.81976
Domain Number - Region: 775-889
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family MIF4G domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_726192.1.81976
Sequence length 1051
Comment Gp150, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSRQSTCRLVLLLAFTLALIHASHSNTVGPKIHFIHDDLTENELNSGEEVSPTESLPKIS
TPKVKDLPVETTTRSPTKKTTSSGTEKSLSEEAWNDLMEAAKHSQALADDPHFNKMLNTT
VAAGEKNSTDTDDSEYYDYDDDYNYFDEETVTISPSPKKAKSNPKLQPIVDATITKSKSK
SNDQKTKESANDIDSDSQYDYDEGLDDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA
RNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIA
NCTLEYLHAEAFHGLNELYAVNLTDVGLAIINPDTFVGNKKLRMLTISGNDLSVMSSIHY
LLKSSSIEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDL
SYNSLTELPRDIFNGTTLSILHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKM
PGLTNLNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNP
RLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKLAWNNINHLPREI
FTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLSLAGNPISRLSVRLFLPLHQLRCLDV
NDCELTTLLSDRDLGAGYKIFDSLRSFNASGNLIKKISSEDVKSFKNLRSLDITNNPLKC
TPDFQEFISYVTLQMQMTPKRLPVLANLEDDATIVQLETLAQAGWSSLAHEVCKHAEGSD
LLDEKKADSAEAKLEKRLKESVKKLNEDEAKLLSVLDKSVLDKSRLSSMQKIMKGSVNTE
TAKPEEDADEENLNNGGEDKEDDSSDYDSEEDDDDDDEDDDDDNNDDDRFEEAKKNAKAK
ADANKAFDTFVNKELKPVLKTDGIQAEEVDMSQETRDKFLLEKLGFDSESEESDEYTEKM
IFHGELSYDLVVPLIVVSFCLLMIVLSIARVIYVVLRKRGERYRMALLASKNSFVYQKLS
EDIVKPTSKEQKEPKHLKQPKVHRYAPINQV
Download sequence
Identical sequences Q24007
FBpp0071726 FBpp0071727 FBpp0071728 FBpp0071726 FBpp0071727 FBpp0071728 NP_001286714.1.81976 NP_726190.1.81976 NP_726191.1.81976 NP_726192.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]