SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_726307.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_726307.1.81976
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-31
Family Bromodomain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_726307.1.81976
Sequence length 268
Comment testis-specifically expressed bromodomain containing protein-3 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAAKQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDL
STVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLY
ICSSGSKVRAEEESSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPA
TLETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAEYCNKELEFDICKLKV
HTKRGIRDYLASKGFTGKRVARTKPKYN
Download sequence
Identical sequences Q9W1S2
FBpp0071950 NP_726307.1.81976 7227.FBpp0071950 FBpp0071950 FBpp0071950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]