SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_726449.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_726449.1.81976
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily L domain-like 2.04e-33
Family Internalin LRR domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_726449.1.81976
Sequence length 240
Comment CG3494, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MYMVCDGLNSPRLQGGKEAEADGSQWPFPDKYHMRNTRILQVSKAQISEVPMEVFEAAQQ
ELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPTNISQYSKLTNLSLSNNLL
CDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIRAIDASESGLGGMR
ELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLSYLRTRIPI
Download sequence
Identical sequences Q0E8W8
FBpp0072202 FBpp0072202 FBpp0072203 7227.FBpp0072202 FBpp0072202 FBpp0072203 NP_611915.1.81976 NP_726449.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]