SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_726994.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_726994.1.81976
Domain Number 1 Region: 304-515,857-990,1090-1124
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.69e-78
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.001
Further Details:      
 
Domain Number 2 Region: 43-73,102-160
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-17
Family Zf-UBP 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_726994.1.81976
Sequence length 1126
Comment ubiquitin specific protease 16/45, isoform E [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVKKRQADSRDHDCSTDSGNEDLHHRKGLGSPGQSDGATPTTASCQHIKKAVDAARLRRL
LKSTGLLYECSQCQKLGKTAGSAAGAGASEGAVGPGGNPVTFEFDNTLWLCLKCGSQLCG
RARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDMKICSNLRKNLLECVELVKKLAQK
PPTSTVTPSTPTISYIEEKLKAALEHLTPIVPMTGGSFDDSSSRGSLAAAGGGGGVGSSR
NRQVAIPMPPPEPSSGLSTSDSLTSVPGMAKRIDQYSATTNGNTGNKRLLTLETPRIENE
RLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLSVLKELSEPGEEFILPGGTFTIKDKGDIE
LPMIKGTLSSWGGLTAALANALEELQAGGSVFTPRKLFDRLCVKCPQFTGGDQHDAHELL
RQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQVFR
GFLVSTLTCQDCHNVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPELSLTSSSSSVTPSTG
QPTINTKFTDGSVNFTASSPSFFLHAHEAASLGPSKSQVKKEKERQRKAKRAAKKRQKSS
LNLNGNDSGNGNELAESVDQDDASLASLGAGDGQANDGLEQTNGQTEDSTTSSVTTSEHS
DADVEDNLVEDTAAPSTNNVPSSTASLTAPSKTYMDSNGNAQPPGEKRDDTPEHMDKDSL
EEDENDSGIATSPAPTATNSSTSTSATGNNNSVAGSGLSGSSGALEDPLAPASLVTAGLS
EKGASVIRQVSVGAEQGASNGTEDADGEAKAIEQPEKTPSQAQAMAQAQARTKRVRTQSY
SDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNT
NATKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNID
RKQKKLLYALYGVVEHSGGMYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQL
KKLEELLAKEKAREQHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQP
QQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERIY
Download sequence
Identical sequences Q9W4C3
NP_001284890.1.81976 NP_572220.1.81976 NP_726993.1.81976 NP_726994.1.81976 NP_726995.1.81976 7227.FBpp0070739 FBpp0070738 FBpp0070739 FBpp0070740 FBpp0070741 FBpp0070738 FBpp0070738 FBpp0070739 FBpp0070740 FBpp0070741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]