SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_727101.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_727101.1.81976
Domain Number 1 Region: 165-197,236-339,390-439
Classification Level Classification E-value
Superfamily TPR-like 3.6e-22
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 2 Region: 23-45,74-113,168-210
Classification Level Classification E-value
Superfamily TPR-like 0.0000149
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_727101.1.81976
Sequence length 528
Comment anaphase promoting complex subunit 7, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQVPPTLRSPRINLM
LARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNGNEINSLVMHAATV
PDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMALGKCLYYNGDYFQ
AEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAH
AQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQAVCAFRTAQMVAPY
RFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLFLFPDPRMRRTARK
FAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVNLLNHLGDIMRKQK
EPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGMDNQQSINDLTTLC
EATNAQGAEGAESVENSREASSSAAARSGQEEDVDEHDWIDVPDGMSY
Download sequence
Identical sequences Q8IRQ6
FBpp0070908 NP_727101.1.81976 FR741 FBpp0070908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]