SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_727842.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_727842.1.81976
Domain Number 1 Region: 538-901
Classification Level Classification E-value
Superfamily Arginase/deacetylase 6.71e-113
Family Histone deacetylase, HDAC 0.000000573
Further Details:      
 
Domain Number 2 Region: 110-468
Classification Level Classification E-value
Superfamily Arginase/deacetylase 9.59e-105
Family Histone deacetylase, HDAC 0.00000202
Further Details:      
 
Domain Number 3 Region: 990-1086
Classification Level Classification E-value
Superfamily RING/U-box 6.22e-26
Family Zf-UBP 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_727842.1.81976
Sequence length 1135
Comment histone deacetylase 6, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLRDIWIQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAA
DPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDES
MSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERL
KETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRP
PGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVY
FSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVAL
EFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLA
EGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQD
RDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFK
VCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAH
TRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRS
GICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFE
SNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQ
LIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGG
YNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRS
LEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSK
PKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGST
GENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYL
NPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN
Download sequence
Identical sequences Q8IR38
FBpp0073827 FBpp0073827 NP_727842.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]