SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_727977.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_727977.1.81976
Domain Number 1 Region: 255-393
Classification Level Classification E-value
Superfamily TRAF domain-like 2.13e-31
Family MATH domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_727977.1.81976
Sequence length 395
Comment TNF-receptor-associated factor-like, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MRSHLKECPRNQHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHL
ITDVGNIRKQNQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSL
KEQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKFFQIEEFLQQ
INEDIKTKLGNSDYVTSKQATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLETQ
MAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNG
KGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKSD
DFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK
Download sequence
Identical sequences Q9VXG5
NP_001245713.1.81976 NP_001245714.1.81976 NP_001259612.1.81976 NP_001259613.1.81976 NP_727977.1.81976 FBpp0074050 FBpp0300830 FBpp0300831 FBpp0306152 FBpp0306153 FBpp0074050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]