SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_728098.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_728098.1.81976
Domain Number 1 Region: 214-284
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000683
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_728098.1.81976
Sequence length 321
Comment uncharacterized protein Dmel_CG15814, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVIILFVTLVIAQ
IILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFIIIWLVFTCITALVMRRAISKP
IQGTTPRLVYKWFYFIYKLSYGLGLVGYLVIIAAFLGMNYMFSQPPNTWMDVGLMFCFYG
LYIGVLGRDISEICSDKMAAAIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENT
YKLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLE
Download sequence
Identical sequences Q9VX13
7227.FBpp0074242 FBpp0074242 FBpp0074243 FBpp0074244 NP_573247.2.81976 NP_728098.1.81976 NP_728099.1.81976 FBpp0074242 FBpp0074243 FBpp0074244 FBpp0074243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]