SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_728648.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_728648.1.81976
Domain Number 1 Region: 5-168,200-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.13e-74
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 358-546
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000501
Family WD40-repeat 0.035
Further Details:      
 
Weak hits

Sequence:  NP_728648.1.81976
Domain Number - Region: 1007-1042,1104-1156
Classification Level Classification E-value
Superfamily TPR-like 0.00195
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_728648.1.81976
Sequence length 1234
Comment coat protein (coatomer) alpha, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLTNFESKSARVKGLSFHPKRPWILVSLHSGVIQLWDYRMHTLLEKFDEHDGPVRGVAFH
QQMPLFVSGGDDYKIKVWNYKQRRCIFTLLAHLDYVRTVAFHHEYPWILSASDDQTIRIW
NWQSRNCICVLTGHNHYVMCAQFHPTEDQIVSASLDQTVRVWDISGLRKKNVAPGPGGLD
DHLKGHPGATDLFGQADAVVKHVLEGHDRGVNWASFHPTLPLIVSGADDRLVKLWRMNEY
KAWEVDTCRGHYNNVSSVLFHPRQDLILSNGEDRSIRVWDMTKRQCLFTFRRDNERFWIL
TAHPTLNLFAAGHDGGMVVFKLERERPAYAVHGNILYYVKERFLRKLDFTTTKDTVVMQL
RPGKSPVYSMSYNPALNAVLICTRTNNLENSTYDLCQIPKDTESQSESDSKRSSGITAIW
VARNRFAVLDRNQQLVIKNFKNEVTKKLPTFCEEIFYAGTGMLLIRDPEFVTLYEVQRLV
SVGSIKLAKCRYVVWSPDMSLVALLCKHSVTICDRRLQYLCTVQENCRVKSGAWDESGVF
IYTTSNHIKYAITNGDHGIIRTLDLPIYLTRVKGNQVFCLDRECRTRVLHIDPTEYKFKL
ALIQRKYDEVLHMVRNARLVGQSIIAYLQQKGYPEVALHFVKDEKTRFGLALECGNIEIA
LEAAKALDDKDCWDRLGQSALLQGNHQVVEMCYQRTKNFDKLSFLYLITGNLEKLKKMNK
IAEIRKDVSAQYQGALLLGDVKERVNILKNCGQLSLAYLTAATHGFDELTESLGESITSQ
GNSLPEVNPNAQLLQPPVPIQQLETNWPLLSVSKGFFEGAMVTRAGSSATARQALNINAD
AALLDEHNGGGDGWGADADLGLDEDGDDEMHDALSNDGDGGAGGEEGAGWDVGDDDLVVP
EELASKIKASALDSNYYAAPNKGLSPAQQWANNSPLVLDHVKAGSFETAFRLLHDQLGVV
NFQPFKTLFLQNYACSRTSYTANPNLQSLSGYPLRNYSETNIKLQRPAVGIKLNDLVARL
QAGYQLTTSGKFSEAVEKFHSILISIPLLVVDTKLDAAEAQQLLRICAEYIVGLKMETVR
KGMPKSTLEEQKRLCEMAAYFTHCKLQPVHQILTLRTALNMFFKLKNYKTAASFARRLLE
LAPRPDVAQQVRKILQACEVNPVDEHQLQYEEFNPFTICGISWKPLYRGKPEVTCPFCSS
SFDPQFKGNLCTVCEVSQIGKDSIGLRISNLQFR
Download sequence
Identical sequences Q9W0B8
FBpp0072693 NP_477395.1.81976 NP_728648.1.81976 7227.FBpp0072693 FBpp0072693 FBpp0072694 FBpp0072693 FBpp0072694 7292122___KOG0292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]