SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_729295.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_729295.1.81976
Domain Number 1 Region: 11-137
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-42
Family Calponin-homology domain, CH-domain 0.00000452
Further Details:      
 
Domain Number 2 Region: 241-293
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000131
Family EB1 dimerisation domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_729295.1.81976
Sequence length 294
Comment uncharacterized protein Dmel_CG32371 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSEKSKTSVVNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFA
RSIPMQRVKFRTNVEYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRK
FFDANYESREYDPVIARNGAMLGLGSPPMEAKLRKSVNKSNPQTKPTEESSAQTDRATTE
PKNQVYKSNSENKTIEEASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGS
IEELRNYCKYVSRMKQERNFYLSKLRAIDHICQKYNSGRDRVILEKITKIIYSE
Download sequence
Identical sequences Q8IQA0
7227.FBpp0076502 FBpp0076502 FBpp0076502 NP_729295.1.81976 FBpp0076502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]