SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_729517.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_729517.1.81976
Domain Number 1 Region: 9-188
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.13e-59
Family Cyclophilin (peptidylprolyl isomerase) 0.00000442
Further Details:      
 
Domain Number 2 Region: 229-374
Classification Level Classification E-value
Superfamily TPR-like 1.86e-24
Family Tetratricopeptide repeat (TPR) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_729517.1.81976
Sequence length 383
Comment CG8336, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEERKLLRAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTL
GKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMAN
YGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDC
GEIAHNEDWGIECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRY
HEARAKYRKANRYYHYLSRQFGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVG
NYTSAREVCNEAIRLDPKCSKAFYRRAQAQRGLRNYEEAINDLKTAHNLLPENKQILNEL
NSTKQLLAQYNRQQRNALKNLFA
Download sequence
Identical sequences Q9VT21
7227.FBpp0076113 NP_001261636.1.81976 NP_648338.1.81976 NP_729517.1.81976 NP_729518.1.81976 FBpp0076113 FBpp0076113 FBpp0076114 FBpp0076115 FBpp0305988 FBpp0076113 FBpp0076114 FBpp0076115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]