SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_730089.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_730089.1.81976
Domain Number 1 Region: 1000-1310
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-66
Family Tandem AAA-ATPase domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 746-998
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-60
Family Tandem AAA-ATPase domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 1410-1532
Classification Level Classification E-value
Superfamily Bromodomain 6.41e-30
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 4 Region: 636-714
Classification Level Classification E-value
Superfamily BRK domain-like 3.01e-22
Family BRK domain-like 0.0021
Further Details:      
 
Domain Number 5 Region: 280-355,400-453
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000000262
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_730089.1.81976
Sequence length 1638
Comment brahma, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MASPSPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPGAYGHPMQ
HGPPGQGPPGHHMPPHHQGMIFSKGPHMGMQMPPTGPNMSPYQTHGMPPNAPTQPCIVSP
GGPPGGPPPPERSSQENLHALQRAIDSMEEKGLQEDPRYSQLLAMRATSKHQHLNGNQVN
LLRTQITAYRLLARNKPISMQMQQALQAAQQQPPPGPPIGPPGAPGGPPPGSQHAGQPPV
PPQQQQQPPPSAGTPPQCSTPPASNPYGPPVPGQKMQVAPPPPHMQQGQPLPPQPPQVGG
PPPIQQQQPPQQQQQQSQPPPPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQPQVRGTL
PGMPPGSQVPQPGGGPQRQVPPAGMPMPKPNRITTVAKPVGLDPITLLQERENRIAARIS
LRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLY
KRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLAR
MNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDE
YISNLTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHVVEQC
TGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKA
QATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKG
LEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLE
FEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIID
EGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQ
WFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMS
ALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCD
HTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFG
YLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQ
DLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSE
RQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGR
ERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDD
GAEFDEEEEEDDSKRKRRKRKNRKEESDDDSLILKRRRRQNLDKRSKKQMHKIMSAVIKH
NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQ
NAQIYNEEASLIYLDSIALQKVFVGARQRITAAADAAAVAAGDNTGEAHGNGGSDNSDND
DDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPTQSSSNVSSGAATTSKKQTRR
KRSQKKYTISDDDDDDMD
Download sequence
Identical sequences P25439
7227.FBpp0075280 NP_536746.1.81976 NP_730089.1.81976 FBpp0075280 FBpp0075281 FBpp0075278 FBpp0075280 FBpp0075281 FR805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]