SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_730961.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_730961.1.81976
Domain Number 1 Region: 256-409
Classification Level Classification E-value
Superfamily ARM repeat 6.62e-37
Family MIF4G domain-like 0.0092
Further Details:      
 
Weak hits

Sequence:  NP_730961.1.81976
Domain Number - Region: 146-230
Classification Level Classification E-value
Superfamily ARM repeat 0.00863
Family MIF4G domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_730961.1.81976
Sequence length 422
Comment krasavietz, isoform D [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSQKTERPVLSGQRIKTRKRDEREKYDPTGFRDAVIAGLEKTEGDLEQISKYLDSAGNKL
DYRRYGEVLFDILIAGGLLVPGGSISQDGEKPRTSYCIFDAPESMESMRNHEQVFVKLIR
RYKYLEKMFEEEMGKVLLFVKGFTPSERIKLARMTALWLVNGSVPPNVLLVLNNEHLIKD
GIALEFLLELFQTFKQEKGIAYLIQALKKGGLESKLMDFFPPNKRTEEYFKQVFLDKELN
EIVKLHKAQASQEAKRELQQALIDDINDEKPYNEITSDIKDFSQRTNIPDHEIIVIIWST
IMSLGEWNKKEELVTDQAVRHLKNYCPLLQAFASTDRSELALILKVQEFCYENMNFMKAF
QKIILLFYKTEVLSEEIILRWYKEGHSNKGKMHFLEQMRKFVEWLQSAEEESESEDEQKN
GE
Download sequence
Identical sequences Q9VNE2
FBpp0078393 FBpp0078394 FBpp0078395 FBpp0078396 FBpp0078397 FBpp0078398 FBpp0078399 FBpp0078393 7227.FBpp0078393 FBpp0078393 FBpp0078394 FBpp0078395 FBpp0078396 FBpp0078397 FBpp0078398 FBpp0078399 NP_524238.1.81976 NP_730958.1.81976 NP_730959.1.81976 NP_730960.1.81976 NP_730961.1.81976 NP_730962.1.81976 NP_730963.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]