SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_731306.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_731306.2.81976
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily RING/U-box 5.06e-17
Family ZZ domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_731306.2.81976
Sequence length 599
Comment uncharacterized protein Dmel_CG11984, isoform H [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSRHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSD
IELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGE
PNLVTDDFAGHLTLEHRQGPRELISFLDEPSAIRHGGGVRRIPGRTLGGPRTRRSNMHFS
SSSGLSALSPSGRESVDPIAELLSQLSGVRRGGPPTSQLQQLQMQMQLDRQQVTASRQID
RLPRRAHPIVSTSNSNAAMAEVISGGAGGSGGSGAVGSGSGGGSGATAPPNLRTTEWPVT
ASFSTSASNHSQTQSSLAANSLNAREAIGTSSSAGSNVLGISVGVGGTANGNGGAGSSGV
ATGAGGAGQGGGQGGAAAGESFLLAQFMQPTFTEAEWAVVESMRADRSMFVQSLMLSMLC
TEALDLNASDESLAKSDNVNKGQQQQQEDAEAEAQAETLLNNNADVEQQQQQQQLQPAMV
RQVNQMQQTSPEDFVCDEYRYKNKKANTTQTSGTGGLGGAGATAAPGGGASGAGTKPTAD
RGIERRSGRPPPGEMATGSQQPQQQQQSTANPAASQQKYKQNASAATAAGNTNQIPDTR
Download sequence
Identical sequences Q95RX5
FBpp0289967 FBpp0289967 FBpp0289968 FBpp0289969 FBpp0289970 FBpp0289971 FBpp0289972 NP_001163560.1.81976 NP_001163561.1.81976 NP_001163562.1.81976 NP_649861.3.81976 NP_731305.2.81976 NP_731306.2.81976 FBpp0289967 FBpp0289968 FBpp0289969 FBpp0289970 FBpp0289971 FBpp0289972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]