SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_731341.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_731341.1.81976
Domain Number 1 Region: 532-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-79
Family Protein kinases, catalytic subunit 0.00000145
Further Details:      
 
Domain Number 2 Region: 13-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.07e-38
Family FCH domain 0.01
Further Details:      
 
Domain Number 3 Region: 431-559
Classification Level Classification E-value
Superfamily SH2 domain 9.56e-23
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_731341.1.81976
Sequence length 804
Comment FER tyrosine kinase, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MGFSSALQSRAAHEALIVRQDAELRLMETMKRSIQMKAKCDKEYAISLTAVAQQGLKIDR
ADEMQGSLISKSWRSYMDELDHQAKQFKFNAEQLEVVCDKLTHLSQDKRKARKAYQEEHA
KIAARLNHLTDEVVRKKSEYQKHLEGYKALRTRFEENYIKAPSRSGRKLDDVRDKYQKAC
RKLHLTHNEYVLSITEAIEVEKDFRNVLLPGLLEHQQSVQESFILLWRNILQEAAQYGDL
TADKYKEIQKRIDTVIGSINPTEEYGEFTEKYKTSPTTPLLFQFDETLIQDIPGKLQSST
LTVDNLTVDWLRNRLQELEGAVRDCQEKQMKMIEHVNGGSPVANGSIISNGSNTSNGIQS
NKDSLCRQSKDLNALRCQEKQKQKLVDMIKCALNEVGCEELPSGCDDDLTLEQNFIENGY
NNEQQISLSTNRPLYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNG
HKHFIVQTTGEGNFRFEGPPFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSND
DVVLLERIGRGNFGDVYKAKLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNI
VKLIGICVQKQPIMIVMELVLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNC
IHRDLAARNCLVDLEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLC
DVWSYGILMWEIFSKGDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADA
ESRPHFDEIYNVVDALILRLDNSH
Download sequence
Identical sequences FBpp0081529 NP_731341.1.81976 FBpp0081529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]