SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_731445.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_731445.1.81976
Domain Number 1 Region: 249-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 183-246
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000121
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_731445.1.81976
Sequence length 643
Comment Fmr1, isoform E [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKYPFVNVRLPPEETVEVAAPIFEEGMEVEVFTRTNDRETCGWWVGIIKMRKAEIYAVAY
IGFETSYTEICELGRLRAKNSNPPITAKTFYQFTLPVPEELREEAQKDGIHKEFQRTIDA
GVCNYSRDLDALIVISKFEHTQKRASMLKDMHFRNLSQKVMLLKRTEEAARQLETTKLMS
RGNYVEEFRVRDDLMGLAIGSHGSNIQAARTVDGVTNIELEEKSCTFKISGETEESVQRA
RAMLEYAEEFFQVPRELVGKVIGKNGRIIQEIVDKSGVFRIKIAGDDEQDQNIPRELAHV
PFVFIGTVESIANAKVLLEYHLSHLKEVEQLRQEKMEIDQQLRAIQESSMGSTQSFPVTR
RSERGYSSDIESVRSMRGGGGGQRGRVRGRGGGGPGGGNGLNQRYHNNRRDEDDYNSRGD
HQRDQQRGYNDRGGGDNTGSYRGGGGGAGGPGNNRRGGINRRPPRNDQQNGRDYQHHNHT
TEEVRETREMSSVERADSNSSYEGSSRRRRRQKNNNGPSNTNGAVANNNNKPQSAQQPQQ
QQPPAPGNKAALNAGDASKQNSGNANAAGGASKPKDASRNGDKQQAGTQQQQPSQVQQQQ
AAQQQQPKPRRNKNRSNNHTDQPSGQQQLAENVKKEGLVNGTS
Download sequence
Identical sequences FBpp0081678 FBpp0081678 NP_731445.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]