SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_731922.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_731922.1.81976
Domain Number 1 Region: 615-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000449
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 339-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000551
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000367
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 473-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000079
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 6 Region: 533-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000127
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 586-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000355
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  NP_731922.1.81976
Domain Number - Region: 422-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000272
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 1256-1282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00439
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_731922.1.81976
Sequence length 1283
Comment CG7987, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MNNQRYGGIQWIQHHVSAGDSSEVDILESDGGAGASGEDLDHVAAENLIFMARDGQLSEI
MAANEAGRTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGI
SSSQELLDMEQDEYTALRPYPCDFCSRRFRKKATLNNHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAAADSSSAIKFEHQTQRQLDDHYYEQEWPLFQHQQEQ
ENAQQNVHQQHQIVEEGGIQLVASYPDTVAQPAAPSRGRISRLKPKEESSQFIVISDKSV
EDSRPYMEPEPAQPVVTTSEFIAVEPPPQPNFPVLDHSKPFVCQQCGLAFAREKALVSHT
KNHRVDSPFECNQCQEMFWDNSSLQEHQKTHQFEESNSEYDPASAEESGSESEADEQLYG
EFYCNECGISFHRQDLLRRHAKMHCKPSDQAAVGSNSDVTAGGDVELAKDSSGHCCNTCG
KSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPSELNANSCVLCGKE
CRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGR
TLSNHRHSHSTTTPGKLFPCLECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGT
LRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYHCTVCSEDLASSN
DLIQHLIQHSDSNTAKQRQPVTGPRKYKRRRKLQPHEIAHMRAANKHVNGDEEEAIGEGD
AEECASDIDFCDFDVENVDDIFDMAESPKKEKRKRGSAATKADAKPVTNGKAAKPAQDKG
KAKPRYDSTSSQQSDRLWEEKFLHDSQVALFQIDSLVVVNDTHLQPASSAVSANIPNTRG
GSKQQGKVQAKSVEGAENLNSSATTSDTTFSASTSTASTRSRKRAATTKTASKAPPASNS
RPRMIHTEKAKVTKGVGGDSTSSSAKKTRSKTYISRTESHNLSLDKSRSSASNMVDDYEI
ISPATHPPNQISSSPLHIKQEQEQQQRVQLMYDDNLLIDAALLREKTYEKFNPSIVNDLE
EILRSPLKHERNSRLRFTSESSTTPQYLHEEEQNLIKIEPTSPDLREMLEGQQRVIAHSG
STPSSSSSARTSRHLRQITANGARAGSKRTTGGVASKTSASPGVVAKKSNTATKVSSSSS
SSYLSYGVDSYNVNVPASANNGDVGSGFFSISEVVSAADAADAAAKAAAAGKSERKTRSF
ECEMCSAIFYDRTQLLEHVHIHI
Download sequence
Identical sequences Q29R10
FBpp0082437 FBpp0082438 7227.FBpp0082437 NP_650375.1.81976 NP_731922.1.81976 FBpp0082437 FBpp0082437 FBpp0082438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]