SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_732265.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_732265.1.81976
Domain Number 1 Region: 467-779
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.59e-50
Family Rhodopsin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 112-365
Classification Level Classification E-value
Superfamily L domain-like 1.21e-20
Family Ngr ectodomain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_732265.1.81976
Sequence length 831
Comment Leucine-rich repeat-containing G protein-coupled receptor 1, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEKHPSLSQRMGTTYRPRKGLKCLSFEFQCRLLLHHLLLTSLSGRHFVYATSAVGGALSA
NNCHDIHHGFDVYPNLTAVSLAQSTDTPLTATMPRSAWKCCCWNASNQAEEVECRCEGDG
LNRVPQTLTLPIQRLTIASAGLPRLRHTGLKVYGSTLLDVAFTDCLQLELIQDGAFANLT
LLRTIYITNAPKLTFLSKDVFLGISDTVDIIRIINSGLTRVPDLGHLPPHNILQMIDLDN
NQITRIDSKSIKVKTAQLILTNNEISYVDDSAFFGSKIAKLSLKENKKLQMMHPNAFDGI
IDITELDLSSTSLVGLPSAGLQNIEALYIQNTHTLKTIPSIYNFRNLQRAYLTHSFHCCA
FQFPSRHDPQRHAQRMLEIEKWRKQCKSDSGTRKERSTLDNPFNMPEDFGSFGGTDDSAT
DITPITFASFDYMADDTMNKGTFHEKIILNPGDDSSAELCGNFTFRKPNIECYPMPNDLN
PCEDVMGYQWLRISVWIVVALAVVGNVAVLTVILSIRPESTPVPRFLMCHLAFADLCLGL
YLLLVACIDAHSMGEYFNFAYDWQYGLGCKVAGFLTVFASHLSVFTLTVITIERWLAITQ
AMYLNHRIKLRPAALIMLGGWIYSMLMSSLPLFGISNYSSTSICLPMENRDVYDTIYLIA
ILGSNGVAFSIIAVCYAQIYLSLGRETRQAHQNSPGELSVAKKMALLVFTNFACWSPIAF
FGLTALAGYPLINVTKSKILLVFFYPLNSCADPYLYAILTSQYRQDLFTLLSKLGLCQQS
ALKYKDSLSGQATTRFTIHGSIQRHSSLTCKMQTVMGAETQKMLKNSEDYV
Download sequence
Identical sequences Q9VEG4
7227.FBpp0082933 FBpp0082933 NP_524393.2.81976 NP_732265.1.81976 FBpp0082933 FBpp0082934 FBpp0082933 FBpp0082934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]