SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_732424.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_732424.1.81976
Domain Number 1 Region: 64-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_732424.1.81976
Sequence length 219
Comment uncharacterized protein Dmel_CG31221, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSFLAMDHHHHHHHQQPRQHHLSMWPSFAVCLLLLQTTTTTMAIDLSRLYGHMANPIVKR
SEACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSL
IASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSV
FMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFLD
Download sequence
Identical sequences Q7JRL9
7227.FBpp0083176 FBpp0083176 FBpp0083176 FBpp0083177 NP_732424.1.81976 NP_732425.1.81976 FBpp0083176 FBpp0083177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]