SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_732964.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_732964.1.81976
Domain Number 1 Region: 207-550
Classification Level Classification E-value
Superfamily DNase I-like 5.5e-38
Family DNase I-like 0.078
Further Details:      
 
Domain Number 2 Region: 64-178
Classification Level Classification E-value
Superfamily L domain-like 5.1e-19
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_732964.1.81976
Sequence length 567
Comment twin, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MCIFKKRDAYHQAVIMKGNHYKMSRNKDKYDSANRRQQIFLSQEDIAAGKKTNWSGLEIT
GCVRNISPSLWEFEHLTALYLNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELI
QLRELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL
SFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKK
SIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDG
CAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM
SEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAV
QLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYKSCLQRLLSNDTNEFTHSFKLAS
AYNEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSD
HFPLLVELELMHTASQQAPPNGLINRR
Download sequence
Identical sequences Q8IMX1
FBpp0083954 7227.FBpp0083954 FBpp0083953 NP_732964.1.81976 FBpp0083954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]