SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_733155.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_733155.2.81976
Domain Number 1 Region: 9-283
Classification Level Classification E-value
Superfamily L domain-like 1.7e-58
Family Internalin LRR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 237-393
Classification Level Classification E-value
Superfamily L domain-like 4.08e-30
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 3 Region: 741-844
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1264-1355
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-24
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 5 Region: 1356-1454
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 951-1054
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_733155.2.81976
Sequence length 1729
Comment scribbled, isoform P [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPDYPPMTLYRSSEKFDSTEFFSYQQKARDLESDSEPFEEREPSRTVVKFSEEAT
QEKETPFVRQNTPHPKDLKAKAQKLKVERSRNEEHANLVTLPEENGTKLAETPTETRTIA
NNHQQQPHPVQQPIVGVNSKQPVVVGVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAA
VVAELAATVGGSDEVQDDDEQEDEFESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKN
KRVQHLTDKQASEILANALASQERNDTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQH
PFDSSLSPISAGKTAEASTDPDNLDGVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFK
GDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQ
REVTRLIGHPVFSEDGSVSQISVETRPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQ
QQQPIQQVAPTHSYSGNVFATPTAAQTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRD
QIGQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEA
HHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSV
VEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPA
PRRTNSVPMGDGDIGAGSTTSGDSGEAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQVHVA
RPNEVGVSAVTVNVNKPQPDLPMFPAAPTELGRVTETITKSTFTETVMTRITDNQLAEPL
ISEEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRIL
KVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGL
NGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRN
AGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSASCSGGSRQGSRASETGSELSQSQS
VSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPL
PTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAA
DAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGA
PSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEEEESQLQLTAEQRIA
Download sequence
Identical sequences FBpp0300856 NP_733155.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]