SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_733379.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_733379.2.81976
Domain Number 1 Region: 172-259
Classification Level Classification E-value
Superfamily TPR-like 0.0000531
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_733379.2.81976
Sequence length 536
Comment uncharacterized protein Dmel_CG31524, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPVLKLLFVVIFFLSLSMGQIEATQPRFARSVVNMDDLLNMEDDLVSKLEGYAEKLSYKA
NTIRWGIQQMREQLDKSKKEQSFDLFNRYSFIRHMQADWLMWKQYLDKPVIRDELNYKQM
DNLRMPQELDLFDASEAIRRMQATYAMLSNDIAEGFLDGVQYTSKLSPIDCLAMGRHLMN
QSRWTIAEQWILAGIKAQDRKGPQTEMILLRGPTKAELFRTLGKVRFERRNEEGALKAYQ
AALKHSPHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEMELPPCCSGRCEGPRKLN
RLYCVYNCVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGALIRSSSKNQILPSETVN
AANEFEIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFES
HFDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHT
EGMLHVRTMHTGCPVIVGSKWVVSKWIDDKGQEFRRPCLRSRLDSKYLSSIEKIII
Download sequence
Identical sequences Q8IMI2
7227.FBpp0085046 FBpp0085046 FBpp0110159 NP_733379.2.81976 FBpp0085046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]