SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_733392.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_733392.2.81976
Domain Number - Region: 133-218
Classification Level Classification E-value
Superfamily TPR-like 0.00104
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_733392.2.81976
Sequence length 453
Comment uncharacterized protein Dmel_CG31021 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRH
MHQDWVGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFYGYEPADLVA
KDERSSSLHLSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNPLGAPRWQ
VYRDLGRTLLKLNRQCAYDAYESALRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKP
TVLEKYCRGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRH
VENAYERCPPNDRFELKLGISGCSISDGYSPVLKRINERILDMAGVEKTWDTFYIVEYAQ
LAPFEPFKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRGNV
LITFENEEHSTTICPIIEGTGLVMIKFIMKTDE
Download sequence
Identical sequences Q8IMH8
FBpp0290205 FBpp0290205 FBpp0290205 NP_733392.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]