SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_742050.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_742050.2.92730
Domain Number 1 Region: 288-493
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.52e-53
Family Reprolysin-like 0.00046
Further Details:      
 
Domain Number 2 Region: 581-638
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1127-1178
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000902
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 919-984
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000876
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 987-1045
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 1051-1112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  NP_742050.2.92730
Domain Number - Region: 877-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.011
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_742050.2.92730
Sequence length 1222
Comment A disintegrin and metalloproteinase with thrombospondin motifs 16 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MESRGCAALWVLLLAQVSEQQTPACALGLAAAASGSPEDPQPPPFSGSSWLETGEYDLVS
AYEVDHRGDYVSHDIMHYQRRRRRRAVTQPGGDALHLRLKGPRHDLHLDLKAASNLMAPG
FMVQTLGKGGTKSVQMFPPEENCFYQGSLRSQGNSSVALSTCQGLLGMIRTKDTDYFLKP
LPPHLTSKLNRSAQGDSPSHVLYKRSTERQAPRENEVLMITRKRDLARPHLHHDNFHLGP
SQKQHFCGRRKKYMPQPPNDDLYILPDEYKPSSRHKRSLLKSHRNEELNVETLVVVDRKM
MQSHGHENITTYVLTILNMVSALFKDGTIGGNINIVIVGLILLEDEQPGLAISHHADHTL
TSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYRSCTVNED
SGLGLAFTIAHESGHNFGMVHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSSCSRQYLHKF
LSTAQAICLADQPKPVKEYKYPEKLPGQLYDANTQCKWQFGEKAKLCMLDFRKDICKALW
CHRIGRKCETKFMPAAEGTLCGQDMWCRGGQCVKYGDEGPKPTHGHWSDWSPWSPCSRTC
GGGISHRDRLCTNPRPSHGGKFCQGSTRTLKLCNSQRCPLDSVDFRAAQCAEYNSKRFRG
WLYKWKPYTQLEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDGMCERVGC
DNVLGSDATEDSCGVCKGNNSDCVTHRGLYSKHHSTNQYYHMVTIPSGARSIHIYETNIS
TSYISVRNSLKRYYLNGHWSVDWPGRYKFSGATFNYKRSYKEPENLTSPGPTNETLIVEL
LFQGRNPGVAWEFSLPRSGAKKTPAAQPSYSWAIVRSECSVSCGGGKMNSKAGCYRDLKV
PVNASFCNPKTRPVTGLVPCKVSPCPSSWSVGNWSVCSRTCGGGTQSRPVRCTRRAHYRD
ESIPASLCPQPEPPIHQACNSQSCPPAWSTGPWAECSRTCGKGWRKRTVACKSTNPSARA
QLLHDTACTSEPKPRTHEICLLKRCHKHKKLQWLVSAWSQCSVTCQGGTQQRVLRCAEKY
ISGKYRELASKKCLHLPKPDLELERACGLIPCPKHPPFDASGSPRGSWFASPWSQCTASC
GGGVQRRTVQCLLRGQPASDCFLHEKPETSSACNTHFCPIAEKRGTFCKDLFHWCYLVPQ
HGMCGHRFYSKQCCNTCSKSNL
Download sequence
Identical sequences Q69Z28
10090.ENSMUSP00000079041 NP_742050.2.92730 ENSMUSP00000079041 ENSMUSP00000079041 ENSMUSP00000079041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]