SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_758825.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_758825.1.100692
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 1.02e-24
Family Pyrin domain, PYD 0.000029
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily DEATH domain 1.73e-18
Family Caspase recruitment domain, CARD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_758825.1.100692
Sequence length 193
Comment apoptosis-associated speck-like protein containing a CARD [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MGRARDAILDALENLTADEFKKFKMKLLTAPVREGYGRIPRGALLQMDPIDLTDKLVSYY
LEGYGLELTMSVLRDMGIQELAEQLQKIMEESGAVATATSVPAQGTARTEHFVDQHRQAL
IARVTKVDGLLDALYGNVLTEGQYQAVRAETPNQNKMRKLFSFAPAWNLTCKNLFLEALR
QTQPYLVTDLEQS
Download sequence
Identical sequences Q8CHK8
NP_758825.1.100692 NP_758825.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]