SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_766113.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_766113.1.92730
Domain Number 1 Region: 681-777,802-889
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 203-470
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.66e-38
Family FCH domain 0.056
Further Details:      
 
Domain Number 3 Region: 606-663
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000001
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_766113.1.92730
Sequence length 1266
Comment rho GTPase-activating protein 29 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MIAHKQKKAKKKRVWASGQPSAAITTSEMGLKSVSSSSSFDPEYIKELVNDVRKFSHMLL
YLKEAILSDCFKEVIHIRLDELLRVLKSILSKHQNLSSVDLQSAAEVLTAKVKAVNFTEV
NEENKNDIFREVFSSIETLAFTFGNILTNFLMGDVGSDSILRLPISRESKSFENISVDSV
DLPHEKGNFSPIELDNLLLKNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNI
VKLAEATRSSIGIQEFMPLQSLFTNALLSDIHSSHLLQQTIAALQANKFVQPLLGRKNEM
EKQRKEIKDLWKQQQNKLLETETALKKAKLLCMQRQDEYEKAKSSMFRAEEEQLSSSVGL
AKNLNKQLEKRRRLEEEALQKVEEANEHYKVCVTNVEERRNDLENTKREILTQLRTLVFQ
CDLTLKAVTVNLFHMQQLQAASLANSLQSLCDSAKLYDPGQEYSEFVKATSSSELEEKVD
GNVNKQMTNSPQTSGYEPADSLEDVARLPDSCHKLEEDRCSNSADMTGPSFVRSWKFGMF
SDSESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSEAGPNSL
GAFKKTLMSKAALTHKFRKLRSPTKCRDCDGIVMFPGVECEECLLVCHRKCLENLVIICG
HQKLQGKMHIFGAEFIQVAKKEPDGIPFVLKICASEIENRALCLQGIYRVCGNKIKTEKL
CQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQE
AKKDSPEDKKHPHVSIEVNRILLKSKDLLRQLPASHFNSLHYLIAHLRRVVDHAEENKMN
SKNLGVIFGPTLIRPRPTTAPVTISSLAEYSNQARLVEFLITYSQKIFDGSLQPQAVVIS
NTGAVAPQVDQGYLPKPLLSPDERDTDHSMKPLFFSSKEDIRSSDCESKSFELTTSFEES
ERRQNALGKCDAPLLDNKVHLLFDQEHESASQKMEDVCKSPKLLLLKSNRAANSVQRHTP
RTKMRPVSLPVDRLLLLASSPTERSSRDVGNVDSDKFGKNPAFEGLHRKDNSNTTRSKVN
GFDQQNVQKSWDTQYVRNNFTAKTTMIVPSAYPEKGLTVNTGNNRDHPGSKAHAEPARAA
GDVSERRSSDSCPATAVRAPRTLQPQHWTTFYKPPNPTFSVRGTEEKTALPSIAVPPVLV
HAPQIHVTKSDPDSEATLACPVQTSGQPKESSEEPALPEGTPTCQRPRLKRMQQFEDLED
EIPQFV
Download sequence
Identical sequences Q8CGF1
NP_766113.1.92730 XP_006501351.1.92730 ENSMUSP00000044624 ENSMUSP00000044624 ENSMUSP00000044624 10090.ENSMUSP00000044624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]