SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_766411.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_766411.1.92730
Domain Number 1 Region: 49-279,313-634
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.32e-144
Family Leishmanolysin 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_766411.1.92730
Sequence length 681
Comment leishmanolysin-like peptidase precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAAAGSGGAGGPGPGPRGRWGGCLWVRGVLLVLGGLPAGAGAAPVSLGTSPPCRHHVLSD
TEVINKVHLKTNHVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTF
QVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREG
KWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANL
CPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSL
GLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGG
MGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGC
EFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEY
QYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNY
GAEQYGPHSVCLLQKSAFIMEQCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRA
GQVLPVRIQMNGWIHNGNLLCPSCWDFCEQCPPETDPPAANLTRALPLDLCSCSSSLVVT
LWLLLGNLFPLLAGFLLCVWH
Download sequence
Identical sequences Q8BMN4
10090.ENSMUSP00000023497 NP_766411.1.92730 ENSMUSP00000023497 ENSMUSP00000023497 ENSMUSP00000023497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]