SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_766429.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_766429.2.92730
Domain Number 1 Region: 133-227,270-382,416-522
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.01e-36
Family LacY-like proton/sugar symporter 0.034
Further Details:      
 
Domain Number 2 Region: 550-604
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 3 Region: 647-761
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000523
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_766429.2.92730
Sequence length 850
Comment solute carrier organic anion transporter family member 5A1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDEGDAQSRAQQQLEAPSSVGAVQEKCESESFRSKSLPVLHSASCRQNFSAGNADGKLAL
GCNEAPGRQETHLGRNLIVPSPSAPSTSAGTTTELMDCNHRMDPSKTVSVSSTLATLQER
RCLYVVLTDSRCFLVCMCFLTFIQALMVSGYLSSVITTIERRYSLKSSESGLLVSCFDIG
NLVVVVFVSYFGGRGRRPLWLAVGGLLIAIGAALFALPHFISPPYQIQELNASASNDGLC
QNGNSTAILEPPPCPKDSGGNSHWIYVALFVCAQVLIGMGSTPIYTLGPTYLDDNVKKDN
ASLYLAIMYVMGALGPAVGYLLGGLLIGFYVDPRNPVHLDQSDPRFIGNWWSGFLLCAIA
MFLVIFPMFTFPKKLPPRHKKKKKFSADVVIDDDIIKEKSNTSEQMNKKVSPMGFGKNVR
DLPRAAVRILSNMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIV
PSAGVGIVLGGYIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGCESINLGGINIPYT
TGPSLTMPHRNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGCINSGNLTTGVRNYT
ECTCVQSRQVITPPTVGQRSQLRVVIVKTYLNENGYAVSGKCKRTCNTLIPFLVFLFIVT
FITACAQPSAIIVTLRSVEDEERPFALGMQFVLLRTLAYIPTPIYFGAVIDTTCMLWQQE
CGVQGSCWEYNVTSFRFVYFGLAAGLKFVGFIFIFLAWYSIKYKEDGLQRRRCREFPLST
VSEQVGQPSKAEKYSRTTSCPAFSTQGEVHEETALQKGFPCTTQTYPGPFSEAVSSSADP
GQDESPDAAL
Download sequence
Identical sequences E9PVD9
ENSMUSP00000111061 10090.ENSMUSP00000111062 NP_766429.2.92730 XP_011236682.1.92730 XP_011236683.1.92730 ENSMUSP00000111062 ENSMUSP00000140091 ENSMUSP00000111062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]