SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_766432.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_766432.1.92730
Domain Number 1 Region: 3-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.33e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 2 Region: 305-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_766432.1.92730
Sequence length 539
Comment flavin containing monooxygenase 9 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MVKKQIAVIGAGISGLGAIKCCLDEDLEPTCFERNDDIGGLWKFQKNASEKMPSIYRSVT
INTSKEMMCFSDFPIPDHFPNYMHNSKLMDYFRMYAKRFSLLDYIRFKTTVRSVRKRPDF
HIHGQWDVVVETDGKQESLVFDGVLVCSGHHTDPHLPLKSFPGIEKFEGCYFHSREYKSP
EDYVGKRIIVVGIGNSGVDIAVELGRVAKQVFLSTRRGSWILHRVWNNGYPMDSSFFTRF
HSFLQKILTTEAVNKYLEKTLNSRFNHAHYGLQPQHRPLSQHPTISDDLPNHIISGKVQV
KPNVKEFTGTDVHFDDGTVEENIDVVIFATGYSISFPFLGDLIAVTDNEVSLYKLMFPPD
LEKPTLAVIGLIQPLGIILPIAELQSRWAVRVFKGLSKLPSVKAMKADMDQRKKAMEKRY
VKTARHTIQVDHIEYMDEIASLAGVKPNLLLLFLSDPTLAMEVFFGPCTPYQYRLQGPGK
WDGARRAILTQRERIIKPLKTRITSEKSRSAPGLFWIKMALFGLAFLVPSLTYFSYICQ
Download sequence
Identical sequences Q8C116
ENSMUSP00000027843 NP_766432.1.92730 ENSMUSP00000027843 ENSMUSP00000027843 10090.ENSMUSP00000027843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]