SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_766526.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_766526.3.92730
Domain Number 1 Region: 320-407
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.47e-19
Family SAM (sterile alpha motif) domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_766526.3.92730
Sequence length 408
Comment sex comb on midleg-like protein 4 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MQTQRVPGRKRGRPPLHSTRVQMAVHNLYSASAASVPAVTIPKKRGRKPRYKIKSPVLMT
PLALSPPRSTPEPDLSSIPQDAATIPSLVVPEALTVCLYINKQADVGPYLERRKLQQLPE
RLGPERPATVLQQAVQACIDCAHQPRLVFSLVKQGYRGELVSVSASFDGKQHLRSLPVVN
SVGYVLRFLTKLCRSLLCDNLFSHLPFPGSIGASDKAQEREDGRTESAKVATAEECLANA
VGMNRYAMDFSHRGSVTHSSSLYKRLTCGDSHLAGGPATTTSGSRTNPVPSGGSSSPGLR
LPASSPKRNGTAIEGNRCAPSPSPEVQDTRRPSSRNPSTWTVEDVVRFVKDADPEALGPH
VELFRKHEIDGNALLLLRSDMIMKYLGLKLGPALKLCYHIDKLKQAKF
Download sequence
Identical sequences Q80VG1
ENSMUSP00000053157 10090.ENSMUSP00000053157 ENSMUSP00000053157 NP_766526.3.92730 ENSMUSP00000053157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]