SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_769305.1.11505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_769305.1.11505
Domain Number 1 Region: 79-612
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 6.98e-121
Family Arylsulfatase 0.0000068
Further Details:      
 
Weak hits

Sequence:  NP_769305.1.11505
Domain Number - Region: 647-781
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.029
Family Laminin G-like module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_769305.1.11505
Sequence length 819
Comment arylsulfatase [Bradyrhizobium diazoefficiens USDA 110]; AA=GCF_000011365.1; RF=reference genome; TAX=224911; STAX=1355477; NAME=Bradyrhizobium diazoefficiens USDA 110; strain=USDA 110; AL=Complete Genome; RT=Major
Sequence
MNFRAIVSILFLTSAISAPAFAQQAQPTTPPPGSPAATITIPGNQLPPPDPKFGGVIKDK
ASESTPWWPPRVVPPKGAPNVLVIMTDDQGFGAPSTFGGIIPTPSMDRIAKAGLRYTNFH
STSLCSPTRAALITGRNHHSVGYGVVGEIATGFPGYDSIIPIEKGTIGTILKANGYATSW
FGKDHNTPSYQSSQAGPFDQWPNGMGFDYFYGFVGGDASQWQPNLFRNTTAIYPFQGNPG
WNLETAMADEAIQHMKQLKEVAPDKPFFVYYVPGATHAPHHPTPEWVKKISDMHLFDEGW
NKVRETIFANQKRLGIMPENAKLTPWPKDLPEWDSLSWDEKKLFIKQADIYGAYLAYADH
EIGRVIQAVEDLGELNNTLIIYIGGDNGASAEGMLNGTPNEFTTFNGVPVPVKDQLLWYP
FWGSERTFPHFAAGWAWTMDTPFKWVKQVPSHFGGTAQGVVMSWPGHITDVGGIRRQFHH
VIDIVPTILEATGISQPDTINGIKQIPIEGVGMTYTWDKANANTASRHTTQYFEMLGNRA
IYQDGWVAATTPATLPWELSTKTPPDVITGYNWELYNVQEDPTQFNDLAAKMPDKLKQMK
DLFYAEAKKYNVLPLDNSTLARWNTPRPSLTAGRTVFTYSGELIGTPASAAPDILNKSYS
ITAEVDIPEGGAEGMIVTHGGRFGGYGLFLSKGEFGVGRGKVVFLYNLLDLKRTTWEGPE
LSAGKHTIAFDFKPDEPGLGKGGTGVLSVDGKEVARNSLEHTIPVTFPEDETFDVGQDTR
TGVALVEYRYDTPFKFTGKINKLTFKLEPEPKSQTTGKN
Download sequence
Identical sequences A0A2A6NA08 Q89RU7
224911.bll2665 gi|27377776|ref|NP_769305.1| NP_769305.1.11505 WP_011085450.1.15658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]