SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_771915.1.11505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_771915.1.11505
Domain Number 1 Region: 23-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000143
Family GntR-like transcriptional regulators 0.056
Further Details:      
 
Domain Number 2 Region: 102-233
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000732
Family GntR ligand-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_771915.1.11505
Sequence length 255
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]; AA=GCF_000011365.1; RF=reference genome; TAX=224911; STAX=1355477; NAME=Bradyrhizobium diazoefficiens USDA 110; strain=USDA 110; AL=Complete Genome; RT=Major
Sequence
MARRKRALEVVRNEDDGEGKPSRRNRLNFFELAYQRIEELLVHCELKPGQFMTMLELQHI
TGFGRTPVHHAVNRLSADTLIIIRPRHGLHIAPIDLARERMLLALRRDMERFVVRLAADR
ASLSHRNQALHIERLLRERRATLTLDEFNHIDRRIDALVLEAAGEPFLVHTLRPLHTLYR
RIGYIHHRFMPGQADLSGTIDHHLAILAAVASRRVDDAVKASDALIDYMGEMFTGMEAGI
DPRLLDCSIEPLLGA
Download sequence
Identical sequences A0A0E4FZ59 A0A0M9BB29 Q89JK8
NP_771915.1.11505 WP_011088031.1.15658 WP_011088031.1.2739 WP_011088031.1.53516 WP_011088031.1.53518 WP_011088031.1.67972 WP_011088031.1.69380 WP_011088031.1.90507 224911.bll5275 gi|27380386|ref|NP_771915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]