SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_776106.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_776106.1.92730
Domain Number 1 Region: 14-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-38
Family Dual specificity phosphatase-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_776106.1.92730
Sequence length 188
Comment dual specificity protein phosphatase 18 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTSPWSAFPVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTF
YEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQLFGKNTMQMMDSPMGRIPDIYEK
ETRLMIPL
Download sequence
Identical sequences Q8VE01
ENSMUSP00000057346 ENSMUSP00000105624 ENSMUSP00000057346 ENSMUSP00000057346 NP_776106.1.92730 XP_006514936.1.92730 10090.ENSMUSP00000057346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]