SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_776367.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_776367.1.76553
Domain Number 1 Region: 198-234
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000112
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 145-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000392
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  NP_776367.1.76553
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000903
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00392
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0262
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_776367.1.76553
Sequence length 243
Comment cleavage and polyadenylation specificity factor subunit 4 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPTKRTPQVIGVMQSQNSSAGSRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFL
SGQ
Download sequence
Identical sequences O19137
ENSBTAP00000002701 ENSBTAP00000002701 9913.ENSBTAP00000002701 NP_776367.1.59421 NP_776367.1.76553 XP_005893184.1.15283 XP_006041397.1.26621 XP_011996953.1.54773 XP_017895695.1.57651 XP_019842660.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]