SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_776401.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_776401.1.59421
Domain Number 1 Region: 47-178
Classification Level Classification E-value
Superfamily EF-hand 6.68e-47
Family p25-alpha 0.00000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_776401.1.59421
Sequence length 218
Comment tubulin polymerization-promoting protein [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVH
GDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALE
ELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFD
PSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK
Download sequence
Identical sequences Q27957
ENSBTAP00000054983 9913.ENSBTAP00000007046 NP_776401.1.59421 NP_776401.1.76553 ENSBTAP00000054983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]