SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_776627.2.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_776627.2.59421
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-87
Family Eukaryotic proteases 0.000000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_776627.2.59421
Sequence length 271
Comment tryptase beta-2 precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MLHLLALALLLSLVSAAPGQALQRAGIVGGQEAPGSRWPWQVSLRVSHQYWRHHCGGSLI
HPQWVLTAAHCVGPEVHGPSYFRVQLREQHLYYQDQLLPISRIIPHPNYYSVENGADIAL
LELDEPVSISCHVQPVTLPPESETFPPGTQCWVTGWGNVDNGRRLPPPFPLKQVKVPVVE
NSVCDRKYHSGLSTGDNVPIVQEDNLCAGDSGRDSCQGDSGGPLVCKVNGTWLQAGVVSW
GDGCAKPNRPGIYTRVTSYLDWIHQYVPQGP
Download sequence
Identical sequences A6QQ05
ENSBTAP00000037407 9913.ENSBTAP00000037407 NP_776627.2.59421 NP_776627.2.76553 XP_019843896.1.53367 ENSBTAP00000037407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]