SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_776681.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_776681.1.76553
Domain Number 1 Region: 128-278
Classification Level Classification E-value
Superfamily EF-hand 4.39e-38
Family Calmodulin-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_776681.1.76553
Sequence length 279
Comment calcium-binding protein 4 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAEEQGRGRHGPDPAPRPQKPPVEVLASSSGAEGPPLMRKRSSKREKGLRGSRKGPSSSG
EQTPMQGPEAPGSSKNPSRTREGQEGPIPSASGLAPRRQSHRHRPGPQHDAAQRMYGPLL
NRIFGKDRELGPEELDELQAAFEEFDTDHDGYIGYRDLGECMRTLGYMPTEMELIEVSQH
VKMRMGGRVDFEEFVEMMGPKLREETAHMLGLRELRIAFREFDRDRDGRITVAELREAAP
ALLGEPLVGPELEEMLQEVDLNGDGTVDFNEFVMMLSRH
Download sequence
Identical sequences Q8HZJ4
NP_776681.1.59421 NP_776681.1.76553 9913.ENSBTAP00000006283 ENSBTAP00000006283 ENSBTAP00000006283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]