SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_776803.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_776803.1.59421
Domain Number 1 Region: 21-141
Classification Level Classification E-value
Superfamily Lysozyme-like 6.88e-48
Family C-type lysozyme 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_776803.1.59421
Sequence length 142
Comment alpha-lactalbumin precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAI
VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI
NYWLAHKALCSEKLDQWLCEKL
Download sequence
Identical sequences B6V3I5 D4P2Z5 L8IIC8 P00711
9913.ENSBTAP00000007701 NP_776803.1.59421 NP_776803.1.76553 XP_005896427.1.15283 XP_010856027.1.44457 ENSBTAP00000007701 ENSBTAP00000007701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]