SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_777242.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_777242.1.76553
Domain Number 1 Region: 316-657
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.97e-131
Family Mammalian PLC 0.00000000124
Further Details:      
 
Domain Number 2 Region: 896-959,1000-1171
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 4.84e-70
Family C-terminal domain of PLC-beta 0.0000272
Further Details:      
 
Domain Number 3 Region: 147-314
Classification Level Classification E-value
Superfamily EF-hand 1.83e-53
Family EF-hand modules in multidomain proteins 0.00000646
Further Details:      
 
Domain Number 4 Region: 17-145
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-42
Family Pleckstrin-homology domain (PH domain) 0.0000375
Further Details:      
 
Domain Number 5 Region: 677-795
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-25
Family PLC-like (P variant) 0.000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_777242.1.76553
Sequence length 1216
Comment 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWEDDSTVVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLDKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPIWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARPTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDNKKKSEPSSPDHVSSTIEQDLAALDAEMTQKLVDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPLMTSDSGKLNQKPPSS
EELEGENPGKEFDTPL
Download sequence
Identical sequences P10894
ENSBTAP00000046644 9913.ENSBTAP00000046644 NP_777242.1.59421 NP_777242.1.76553 ENSBTAP00000046644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]