SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_788715.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_788715.2.81976
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.25e-64
Family Penicillin synthase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_788715.2.81976
Sequence length 322
Comment uncharacterized protein Dmel_CG33093 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFD
GFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQL
PGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYP
PVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGE
TMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSD
VIQNAYDITMALAKGAFAHHYS
Download sequence
Identical sequences Q86B82
NP_788715.2.81976 FBpp0083680 FBpp0083680 7227.FBpp0083680 FBpp0083680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]