SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_788723.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_788723.1.81976
Domain Number 1 Region: 269-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000298
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  NP_788723.1.81976
Domain Number - Region: 554-594
Classification Level Classification E-value
Superfamily RING/U-box 0.000159
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number - Region: 76-99
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0173
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number - Region: 245-267
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.022
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 108-145
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0408
Family CCCH zinc finger 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_788723.1.81976
Sequence length 599
Comment unkempt, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLANETNKLLLSSQQEKPNHYTYLKEFRVEQCQSFLQHKCNQHRPFVCFNWHFQNQRRRR
PVRKRDGTFNYSADNYCTKYDETTGICPEGDECPYLHRTAGDTERRYHLRYYKTCMCVHD
TDSRGYCVKNGLHCAFAHGMQDQRPPVYDIKELETLQNAESTLDSTNALNALDKERNLMN
EDPKWQDTNYVLANYKTEPCKRPPRLCRQGYACPQYHNSKDKRRSPRKYKYRSTPCPNVK
HGEEWGEPGNCEAGDNCQYCHTRTEQQFHPEIYKSTKCNDVQQAGYCPRSVFCAFAHVEP
CSMDDPRENSLSASLANTSLLTRSSAPINIPNTTLSNSINDFNSGSFAVNIPSSSLTYSP
TNHANLFNVDAFNYGGSNKLSNSLSATQNDSSLFFPSRIISPGFGDGLSISPSVRISELN
TIRDDINSSSVGNSLFENTLNTAKNAFSLQSLQSQNNSDLGRITNELLTKNAQIHKLNGR
FEDMACKLKIAELHRDKAKQEAQEWKERYDLAQIQLNLPAELRDLSIQKLKQLQSKLRTD
LEEVDKVLYLENAKKCMKCEENNRTVTLEPCNHLSICNTCAESVTECPYCQVPVITTHT
Download sequence
Identical sequences A0A0B4K6Y4 Q86B79
7227.FBpp0083794 FBpp0083794 FBpp0083795 NP_001247253.1.81976 NP_001247255.1.81976 NP_788722.1.81976 NP_788723.1.81976 FBpp0083794 FBpp0083795 FBpp0294022 FBpp0294024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]