SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_788753.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_788753.1.81976
Domain Number 1 Region: 623-908
Classification Level Classification E-value
Superfamily TPR-like 1.99e-43
Family HAT/Suf repeat 0.0077
Further Details:      
 
Domain Number 2 Region: 313-500
Classification Level Classification E-value
Superfamily TPR-like 8.35e-34
Family HAT/Suf repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_788753.1.81976
Sequence length 1009
Comment CG1646, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVQEEEEPFRGTNTAEAPALEPQFEETQHQIEDDVEMLPAEAAGVDEKSSSFPFGTVAEL
HSETSDDIKETRGQAGVDTLLASLAGDNANSLPSVGGNDESDNVKKADFEYNVDSLQPQM
EKMNSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDELPLPSKPEINDAEEVSDEELP
APQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHESSTK
DKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEK
ERKKLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWR
KYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERAVK
ACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQHDVT
ITLANEEVIRLRKDFHERQQSKSSKSSSKHRRDSSSSSKDKDSKEREREKDKDKDKDKDK
EKRETVGGGVGKSPKDTSETQVDESDSTTDLTTESESSHAASKPAMQIDFSDLSTLNDEE
VVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDFEIE
KGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHHPDK
PSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCRELYKH
YIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLCLQR
PKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQALTK
AKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQQNT
AAAYPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWSGYGNYY
Download sequence
Identical sequences FBpp0084692 FBpp0084694 FBpp0112211 FBpp0084692 FBpp0084694 FBpp0112211 NP_001097957.1.81976 NP_651634.1.81976 NP_788753.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]