SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_796298.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_796298.2.92730
Domain Number 1 Region: 1102-1241,1323-1611
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.59e-105
Family Myotubularin-like phosphatases 0.000007
Further Details:      
 
Domain Number 2 Region: 1680-1701,1731-1869
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-30
Family Pleckstrin-homology domain (PH domain) 0.0000235
Further Details:      
 
Domain Number 3 Region: 873-1015
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-16
Family GRAM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_796298.2.92730
Sequence length 1872
Comment myotubularin-related protein 13 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MARLADYFIVVGYDHEKPAGPGEGLGKIIQRFPQQDWDDTPFPQGIELFCQPGGWHLSRE
RKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEEVSGLIQPAEVFAPKS
LVLVSRLDYPEIFRACLGLIYTVYVDSMSVSLESLIANLCACLVPAAGGSQKLFSLGAGD
RQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLNLFCAVLTENKVLFHSASFQRLSDACRA
LESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSIFKTDVHELLDVIIADLDGGTI
KIPECIHLSSLPEPLLHQTQSALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFL
RLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLNGMAFAGFVSER
GPPYRACDLFDELVAFEVERIKVEEKNPLKMIKHIRELAEQLFKNENPNPHMAFQKVPRP
TEGSHLRVHILPFPKINEARVQELIQENLAKNQNAPPATRIEKKCVVPAGPPVVSIMEKV
ITVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQCLTDELGLHVQQNR
AILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDH
PIWTNQQFWETTFYNAVQEQVRSLYLSAKDDNHIPHLKQKLPDGQHQEKTAMDLAAEQLR
LWPTLSKSTQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRASAPGDWESGSN
SIVTNSIAGSVAESYDTESGFEDSENSDVANSVVRFIARFIDKVCTESGVTQDHIRSLHC
MIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREEAT
GGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITMQNQL
QQSVQEGLQITSASFQLIKVAFDEEVSPEVVDIFKKQLMKFRYPQSIFSTFAFAAGQTTP
QIILPKQKEKNTSFRTFSKTIVKGAKKAGKMTIGRQYLLKKRTGTIVEERVNRPGWNEED
DISVSDDSELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGNSSRSKPEYFRVTA
SNRLYSLCRSYPGLLVIPQAVQDSSLPRVARCYRHNRLPVVCWKNSRSGTLLLRSGGFHG
KGVVGLFKSQNSPQAVSTSSLESSSSIEQEKYLQALLTAVIVHQKLRGSSTLTVRPALAL
SPVHGYRDKSFTQSNPKSSAKEPVHNQGVWASLRSSTRLISSPTSFIDVGARLAGKDHSA
SFSNSTYLQNQLLKRQAALYIFGEKSQLRSSKVEFAFNCEFVPVEFHEIRQVKASFKKLM
RACIPSTIPTDSEVTFLKALGDSEWFPQLHRIMQLAVVVSEVLENGSSVWVCLEEGWDIT
TQVTSLAQLLSDPFYRTIAGFRTLVEKEWLSFGHKFSQRSSLALNSQGGGFAPIFLQFLD
CVHQVHNQYPTEFEFNLYYLKFLAFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHAKK
GVCIWECIDKMHTRSPIFFNYLYSPVEVEALKPNVNVSSLKKWDYYTEETLSAGPSYDWM
MLTPKHFPYEESDVAGGAGPQSQRKTVWPCYDDVTCSQPDALTRLFSEIEKLEHKLNQTP
ERWHQLWEKVTTDLKEEPRTAHSLRHSAGSPGIASTNVPSYQKRPALHPLHRGLGEDQST
TTAPSNGVEHRAATLYSQYTSKNDENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYY
DSGEDTSCKGHIDLAEVEMVIPAGPSMGAPKYTSDKAFFDLKTSKRVYNFCAQDGQSAQQ
WMDRIQSCISDA
Download sequence
Identical sequences E9PXF8
NP_796298.2.92730 ENSMUSP00000033058 ENSMUSP00000033058 ENSMUSP00000033058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]