SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_808262.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_808262.1.92730
Domain Number 1 Region: 119-502
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.36e-135
Family Myotubularin-like phosphatases 0.0000000584
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-19
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_808262.1.92730
Sequence length 545
Comment myotubularin-related protein 9 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEFAELIKTPRVDNVVLHRPFYTAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSVTLMYPFFYRPMFEVI
EDGWHSFLPEQEFEFYSSATSEWRLSYINKDFSICPSYPPTVIVPKSVDDEALRKVAAFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYLIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHVLQESLIKLVEACNEQTHNMDRWLGKLE
ASNWLTHIKEILTTACLAAQCIDREGASVLIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCSSKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEH
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPGELSKFTNPLFEANNL
VIWPSVAPQSLQLWEGIFLRWSRSSKYLDEAYEEMVNIIEYNKELQAKVNVLRRQLAELE
TEDGL
Download sequence
Identical sequences Q9Z2D0
NP_808262.1.92730 ENSMUSP00000059894 ENSMUSP00000059894 ENSMUSP00000059894 10090.ENSMUSP00000059894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]