SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_810196.1.73244 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_810196.1.73244
Domain Number 1 Region: 197-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.54e-22
Family Clostridium neurotoxins, the second last domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_810196.1.73244
Sequence length 440
Comment hypothetical protein BT_1283 [Bacteroides thetaiotaomicron VPI-5482]; AA=GCF_000011065.1; RF=reference genome; TAX=226186; STAX=818; NAME=Bacteroides thetaiotaomicron VPI-5482; strain=VPI-5482; AL=Complete Genome; RT=Major
Sequence
MKKQKIRFAIFMLLLAVTACDNADYSKSAPFDNGVYLSVAESKTSETMTFNKTIIQREKS
FTARLAYPAGTDVTVNVTVDPSQVEAYNSRNNTSYDILPAKHYRLESNEMTIRAGKINSA
PLHIYFENLTELEIDKAYLCPVSLNSAQGVGLLDGSTTYWYIVKRSSAITTAVDLRYCYV
EVPGFYVPKWGTEPAGNAAHLNNLKAVTFEIITRISNFDEANTDISSLMGIEQYFCFRAG
DAGFPRQQLQIQTPAGKFPEANKAKLLKENEWYHLALTYDIATKTIIFYVNGKEQSRSTN
YGNSEFSEIKLANRKQESFPGASDGDWLFYIGRSYNDRWLIDRQLNGNVCEARIWDVART
QQEIWKNMYDIEDPENEAHLAAYWKFNEGSSNDIKDYSKYHNDAHIVRYWKDFNSKEEYD
VKNEELWPSGIEVPQVNRED
Download sequence
Identical sequences A0A2J6A9R1 Q8A891
226186.BT_1283 NP_810196.1.73244 WP_011107688.1.24025 gi|29346693|ref|NP_810196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]