SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_834671.1.86172 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_834671.1.86172
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.84e-26
Family Tetracyclin repressor-like, C-terminal domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000227
Family Tetracyclin repressor-like, N-terminal domain 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_834671.1.86172
Sequence length 183
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]; AA=GCF_000007825.1; RF=reference genome; TAX=226900; STAX=1396; NAME=Bacillus cereus ATCC 14579; strain=ATCC 14579; AL=Complete Genome; RT=Major
Sequence
MMSPRIGLTLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLG
IYGIKKLHNRLEEAAEDKRMDEAIHALGEAYVAFVRKHPGLYEATFLRDEEVRKAGDGIV
KLCLQVLQQYGLEGENALHATRGFRSICHGFASIEQQGGFGLPLDLDISLHVLLETFIKG
LRE
Download sequence
Identical sequences Q815X4
1zk8A gi|30023040|ref|NP_834671.1| 226900.BC5000 APC26195 1zk8_A 1zk8_B NP_834671.1.86172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]