SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_848932.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_848932.1.87134
Domain Number - Region: 49-100
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0572
Family Cytochrome c3-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_848932.1.87134
Sequence length 172
Comment melanocortin-2 receptor accessory protein isoform alpha [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Download sequence
Identical sequences Q8TCY5
NP_848932.1.87134 NP_848932.1.92137 XP_006724091.1.92137 gi|30520312|ref|NP_848932.1| ENSP00000306697 ENSP00000306697 ENSP00000382684 9606.ENSP00000306697 ENSP00000306697 ENSP00000382684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]