SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_851835.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_851835.1.92730
Domain Number 1 Region: 1-468
Classification Level Classification E-value
Superfamily Ras GEF 6.67e-121
Family Ras GEF 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_851835.1.92730
Sequence length 472
Comment ras-GEF domain-containing family member 1B isoform 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDR
TYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSEGDGDKNQMRKIAPKILQLLTEWTET
FPYDFRDERMMRNLKDLAHRMASGEETYRKNVQQMMQCLIRKLAALSQYEEVLAKLSSTA
TDRLTVLKTKPQSIQRDIMTVCSDPYTLAQQLTHIELERLNYIGPEEFVQAFVQKDPLDN
DKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPVKKKHRARMIEYFIDVARECFNIGN
FNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPSSNFYNYRTALRGAAQRSLT
AHSSREKIVIPFFSLLIKDIYFLNEGCVNRLPNGHVNFEKFWELAKQVSEFMTWKQVECP
FERDRKVLQYLLSVPVFSEDALYLASYESEGPENNIEKDRWKSLRSSLLGRV
Download sequence
Identical sequences ENSMUSP00000129652 NP_851835.1.92730 XP_021066082.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]