SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_852077.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_852077.1.92730
Domain Number 1 Region: 718-1163
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-54
Family Hermes transposase-like 0.005
Further Details:      
 
Domain Number 2 Region: 459-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000167
Family BED zinc finger 0.031
Further Details:      
 
Domain Number 3 Region: 287-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000893
Family BED zinc finger 0.069
Further Details:      
 
Domain Number 4 Region: 117-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000988
Family BED zinc finger 0.055
Further Details:      
 
Domain Number 5 Region: 560-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000119
Family BED zinc finger 0.079
Further Details:      
 
Domain Number 6 Region: 654-713
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.0000000262
Family Hermes dimerisation domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_852077.1.92730
Sequence length 1168
Comment zinc finger BED domain-containing protein 4 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEDKQETCPKGDSDFVSDKVNFKTEEDDDQTPCHSLEQVDFKSESEDMRQTDSGDEQADI
RAASCACQPSGKFLAAESEDDYGSLFSQYSSTLYSVAMEAVTQSLLSSRHISSRKKSPAW
KHFFISPRDSTKAICTYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTKLIQENGSLSAGSS
FSPPSLLLPPQPADVGDLSTVLSPVRLVQKMAPKIPSPDQIMEESVTVVSSEELSSDVSV
TEKYSREEALAGSSPNLSMLHYDDASETMADRNLSLPKSTSGSRRRSAVWKHFYLSPLDS
SKAVCVHCMNEFSRGKNGKDLGTSCLIRHMWRAHRSIVLQENGGNTGIPPLYPMPPTLLP
ALLPPEGDLNSASLSPGKQVKESPSASSSPERLPEDLSSHTNPGDVSREDVSMLSSSDDL
GEASVVSSPEKQPADTVNPRFESGTVFQQNKKVMRRLKSEVWHHFSLAPMDSLKAVCRYC
SCVISRGKKGDVGTSCLMRHLYRRHPEVVGNQKDFLGASLANSPYATLASAESSSKLTDL
PAVVRKNHQGVFPTNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLL
RHLQRFHGHVLKNDVSEATLSRSPGIRRPLGIELSGPSSFRDSTEKFYDSHPVAKKITSL
IAEMIALDLQPYSLVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIIMSHLK
EAESGVVHFTSGIWMSSQTREYLTLTAHWVTFASAVRPHCEDHHCSALLDVSQIDCDYSG
NSIQKQLECWWEAWVTSIGLQIGITVTDNPSIGKMLSEGEHSSVQCFSHTVNLIVSEAIK
SQRMVQNLLSIARKLCERVHRSPRAREKLAELQKEYELPQHQLIQDVPSKWSTSFHMLER
LIEQKRAVNEVSIECNFRELISCDQWEVMQSVCHVLRPFDAASREMSAHMSTLSQVIPMI
HILSRKVEMLFGETMGIDTMLKSLKEAMASRLSATLHDPRYIFATLLDPRYKASLFTEEE
AEQYRQDLIRELEILNSTSEDTATSNGCDSGSPLKDTGTEESLWSLAPIKRDQREKLPED
MVLAYLEEEVLEHSCDPLTYWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGS
FGQPRLMMEHFEKLIFLKVNLPLICFQY
Download sequence
Identical sequences Q80WQ9
NP_852077.1.92730 XP_006520903.1.92730 XP_006520904.1.92730 ENSMUSP00000035437 ENSMUSP00000035437 10090.ENSMUSP00000105003 ENSMUSP00000035437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]