SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_853522.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_853522.2.92730
Domain Number 1 Region: 1120-1225
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.06e-26
Family Lipoxigenase N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 34-147
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000388
Family C-type lectin domain 0.051
Further Details:      
 
Weak hits

Sequence:  NP_853522.2.92730
Domain Number - Region: 1898-1948,1986-2111
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000698
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_853522.2.92730
Sequence length 2151
Comment polycystic kidney disease protein 1-like 3 isoform b precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLLQRRSWLWLYIRIGVILGDILGRKPSIREQHGGNSCYQLNRLFCDFQEADNYCHAQRG
RLAHTWNPKLRGFLKSFLNEETVWWVRGNLTLPGSHPGINQTGGDDVLRNQKPGECPSVV
THSNAVFSRWNLCIEKHHFICQAAAFPPQGASIWRNEFGPGPLLPMKRRGAETERHMIPG
NGPPLAMCHQPAPPELFETLCFPIDPASSAPPKATHRMTITSLTGRPQVTSDTLASSSPP
QGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPA
SSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQGT
LDTPSSSSPPQGTSDTPASSSPPQGTSETPASNSPPQGTSETPGFSSPPQVTTATLVSSS
PPQVTSETPASSSPTQVTSETPASSSPTQVTSDTPASNSPPQGTSDTPGFSSPTQVTTAT
LVSSSPPQVTSDTPASSSPPQVTSDTPASSSPPQVTSETPASSSPPQVTSDTSASISPPQ
VISDTPASSSPPQVTSETPASSSPTNMTSDTPASSSPTNMTSDTPASSSPTNMTSDTPAS
SSPPWPVITEVTRPESTIPAGRSLANITSKAQEDSPLGVISTHPQMSFQSSTSQALDETA
GERVPTIPDFQAHSEFQKACAILQRLRDFLPTSPTSAQVSVANLLIDLSEQLLVLPFQKN
NSWSSQTPAVSCPFQPLGRLTTTEKSSHQMAQQDMEQVEDMLETSLMALGEIHRAFCQQS
LCPQSAVTLASPSATLMLSSQNVSTLPLSTYTLGEPAPLTLGFPSAEALKELLNKHPGVN
LQVTGLAFNPFKTLDDKNIVGSIGNVQLSSAYQSIRVHDLIEDIEIMLWRNASMETQPTS
LNTSTDHFTISVNITSLEKTLIVTIEPESPLLMTLHLGFQDQLAHTHFYLNISLPRDQVW
QKDEEYTWVLTPENLWYGTGTYYIMAVENKSTEAAQHTPVLVSVVTAVTQCYFWDRYNRT
WKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIKLLLHVTNNPVGVSLL
SSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVV
ITLYGSEGHSEPHHLCDPEKTVFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYV
SQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQ
DYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQLGPLAVT
LSELLVSIQTSIILFPIHLIFGRLFQLIHPPEALPQLPFIQAAWPPALVCESPSLTQVVK
ELKETVGFLLRRNTQLLSECEPSSCSSCDINKLAKLLSGLIYCHLEDEGCHQQTESHWED
AVSENHYHFCRYLLQLLRRLKAHLEALGATQDHQSCDFSEAVSQLQNLQELLETQTLRRG
PGPCRHSTSFPILSPGEGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQ
ATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCP
WSAPGLRDKNNPIYTAPAMNNLAKPTRKAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKD
SSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTLLPNLYGDYRGFITDGNSFLLGNVLI
RQTRIPNDIFFPGSLHKQMKSPPQHQEDRENYGAGWVPPDTNITKVDSIWHYQNQESLGG
YPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLL
CAVTLILESSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKR
QRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNS
AVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEVLGFILIIVVLLSSYAMTFN
LLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLLVLSSIILMGLVIINLF
VSAILIAFGKERKACEKEATLTDMLLQKLSSLLGIRLHQNPSEEHADNTGY
Download sequence
Identical sequences A2A258
NP_853522.2.92730 ENSMUSP00000051512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]